PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00349g03001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CPP
Protein Properties Length: 972aa    MW: 104751 Da    PI: 6.5002
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00349g03001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR482.4e-15526563340
                       TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                               +k+CnCkkskClk+YC+Cfaag +C+ +C C++C+N+ 
  Niben101Scf00349g03001.1 526 CKRCNCKKSKCLKLYCDCFAAGIYCAGSCACQGCFNRL 563
                               79**********************************86 PP

2TCR48.51.8e-15640678139
                       TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                               ++k+gC+Ckks ClkkYCeC++a++ Cs+ C+Ce+CkN 
  Niben101Scf00349g03001.1 640 RHKRGCSCKKSMCLKKYCECYQANVGCSSGCRCEGCKNV 678
                               589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.5E-15524565IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.026525680IPR005172CRC domain
PfamPF036383.0E-11527562IPR005172CRC domain
SMARTSM011145.5E-17640681IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.1E-11642677IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 972 aa     Download sequence    Send to blast
MDSPEPSSKT TTINSTINPT LAEDSPVFSY ISNLSPIQPV KAAPVVQGFP GLNSPPLLFT  60
SPRVSAHGRL RRSQFPQLSS EVFSGKNEDY NNAITDSDGN GVAVSQLRSE LSPSVQKVSD  120
DNISVLDESG SLIRCVDEFL VDVSNSESAN PSNSTNSSPK VADNIPQSPN SAAESVADFA  180
SKDARKDEIP KDAARVVVEQ PEEENKGIYN TSTDSDLPSP DLCTKIEPDL PADNSLHYHY  240
SDRQMAQLSQ ADHATLDEAS DIPTEPLENA HDCRNVNDKI NSMSSAPDEC IMQHDSQTKA  300
GQYQSGIRRR CLQFEDAQRK ISPTSVGLQN ASDVVSCSIP PVSPAVIEVV ASGSSNKSST  360
ASSRPSTQLT SSSDNFGSFA VTVPKPSGIG LHLNSIAMQA GSRGSRATVS VKSAERGNLS  420
ISGKKLMSMM SCHPSENLKS CLISSNVVGN HLTTGDNDGE HESYGTNAES AASLHLNAAK  480
PLNNTVLLKP TEHTISLKRK SSSKYIDSSM NYNQKKPSDA YDGDGCKRCN CKKSKCLKLY  540
CDCFAAGIYC AGSCACQGCF NRLEYEDTVN DVRQQIQSRN PLAFCPKIVQ HPTDSPASII  600
GVFNSSKSFF YSGRSISSQL TYLLAILQAE GASFTPPSAR HKRGCSCKKS MCLKKYCECY  660
QANVGCSSGC RCEGCKNVYG LKEEYGKDLV KKHCITERWE KPAEEKVEMA TATSGLLQID  720
PRNQCNLTPP TPSFQCSNRG KNASKSWFTA GRYLSSPESG QTIYGLSPAS PTSSKNHDID  780
QESTGDIMDL VTFDQEFNYG NAKLANEFSP GFHVTGNTDD LLALPKSQDL ASNIGGQLIP  840
QTVHFQSTWP LSWRDSPITP MNQFDGGGMN ALELLNSDKK PYAMEDDTPE ILKDSSMPQT  900
GVKVSSPNKK RISPPNRHLN ELGSSSSGGG LKTGRKFILR AVPSFPPLTP CIDSKDVATH  960
STDNSQKGGS SK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009763114.10.0PREDICTED: CRC domain-containing protein TSO1-like
TrEMBLK4CLU10.0K4CLU1_SOLLC; Uncharacterized protein
STRINGSolyc08g067150.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA69802128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.12e-50Tesmin/TSO1-like CXC domain-containing protein